| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1. This antibody reacts with human. The Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LRRRKQGDKKTFDECVAEGGSDCAPEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLE |
|---|
| Other Names | 2OST, 2-O-sulfotransferase, EC 2.8.2, EC 2.8.2.-, FLJ11317, heparan sulfate 2-O-sulfotransferase 1, HS2ST, KIAA0448dJ604K5.2, MGC131986 |
|---|
| Gene, Accession # | HS2ST1, Gene ID: 9653 |
|---|
| Catalog # | NBP1-91983 |
|---|
| Price | |
|---|
| Order / More Info | Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|