| Edit |   |
|---|
| Antigenic Specificity | Hemoglobin gamma-2 chain |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Hemoglobin gamma-2 chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Hemoglobin gamma-2 chain. This antibody reacts with human. The Hemoglobin gamma-2 chain Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | The immunogen for this antibody is Hemoglobin gamma-2 chain - middle region. Peptide sequence MGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFK. |
|---|
| Other Names | hemoglobin subunit gamma-2, hemoglobin, gamma G, TNCY |
|---|
| Gene, Accession # | HBG2, Gene ID: 3048, Accession: NP_000175, SwissProt: NP_000175 |
|---|
| Catalog # | NBP1-98291 |
|---|
| Price | |
|---|
| Order / More Info | Hemoglobin gamma-2 chain Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|