| Edit |   |
|---|
| Antigenic Specificity | Calpain 13 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Calpain 13 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Calpain 13. This antibody reacts with human. The Calpain 13 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Calpain 13 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DIDATQLQGLLNQELLTGPPGDMFSLDECRSLVALMELKVNGRLDQEEFARLWKRLVHYQHVFQKVQTSPGVLLSSDLWKAIENTDFLRGIF |
|---|
| Other Names | Calcium-activated neutral proteinase 13, calpain 13, calpain-13, CANP 13, EC 3.4.22.-, FLJ23523 |
|---|
| Gene, Accession # | CAPN13, Gene ID: 92291, Accession: Q6MZZ7, SwissProt: Q6MZZ7 |
|---|
| Catalog # | NBP2-33920 |
|---|
| Price | |
|---|
| Order / More Info | Calpain 13 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|