| Edit |   |
| Antigenic Specificity | HEATR4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The HEATR4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to HEATR4. This antibody reacts with human. The HEATR4 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide directed towards the N terminal of human HEATR4The immunogen for this antibody is HEATR4. Peptide sequence VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN. |
| Other Names | HEAT repeat containing 4, HEAT repeat-containing protein 4, MGC48595 |
| Gene, Accession # | HEATR4, Gene ID: 399671, Accession: NP_976054, SwissProt: NP_976054 |
| Catalog # | NBP1-79609-20ul |
| Price | |
| Order / More Info | HEATR4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |