| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GSTA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GSTA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GSTA1. This antibody reacts with human. The GSTA1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human GSTA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMD |
|---|
| Other Names | EC 2.5.1.18, glutathione S-alkyltransferase A1, glutathione S-aryltransferase A1, glutathione S-transferase 2, glutathione S-transferase A1, glutathione S-transferase alpha 1, glutathione S-transferase Ha subunit 1, GST class-alpha member 1, GST HA subunit 1, GST, class alpha, 1, GST2, GSTA1-1, GST-epsilon, GTH1, MGC131939, S-(hydroxyalkyl)glutathione lyase A1 |
|---|
| Gene, Accession # | GSTA1, Gene ID: 2938, Accession: P08263 |
|---|
| Catalog # | NBP2-46817 |
|---|
| Price | |
|---|
| Order / More Info | GSTA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|