| 产品详情 |
| Edit |   |
| Antigenic Specificity | SH3MD4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SH3MD4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SH3MD4. This antibody reacts with human. The SH3MD4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SH3MD4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LISSSDPRAAARIGDLAHLSCAAPTQDVSSSAGSTPTAVPRAASVSGEQGTPPKVQLPLNVYLALYAYKPQKSDELE |
| Other Names | EC 6.3.2, Plenty Of SH3s 2, Plenty Of SH3s-2, POSH2, SH3 Domain Containing Ring Finger 3, SH3 Domain-Containing RING Finger Protein 3, SH3 Multiple Domains 4, SH3 Multiple Domains Protein 4 |
| Gene, Accession # | SH3RF3, Gene ID: 344558, Accession: Q8TEJ3, SwissProt: Q8TEJ3 |
| Catalog # | NBP2-31005 |
| Price | |
| Order / More Info | SH3MD4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|