| Edit |   |
| Antigenic Specificity | SHKBP1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | mouse |
| Isotype | n/a |
| Format | immunogen affinity purified, no preservative |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SHKBP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHKBP1. This antibody reacts with mouse. The SHKBP1 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptide towards Shkbp1. Peptide sequence RGAPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAI. |
| Other Names | PP203, Sb1, SH3KBP1 binding protein 1, SH3KBP1-binding protein 1 |
| Gene, Accession # | SHKBP1, Gene ID: 92799, Accession: NP_619617 |
| Catalog # | NBP1-82392-20ul |
| Price | |
| Order / More Info | SHKBP1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |