| Edit |   |
|---|
| Antigenic Specificity | SHKBP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SHKBP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SHKBP1. This antibody reacts with mouse. The SHKBP1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptide towards Shkbp1. Peptide sequence RGAPGEVIHLNVGGKRFSTSRQTLTWIPDSFFSSLLSGRISTLKDETGAI. |
|---|
| Other Names | PP203, Sb1, SH3KBP1 binding protein 1, SH3KBP1-binding protein 1 |
|---|
| Gene, Accession # | SHKBP1, Gene ID: 92799, Accession: NP_619617 |
|---|
| Catalog # | NBP1-82392-20ul |
|---|
| Price | |
|---|
| Order / More Info | SHKBP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|