| Edit |   |
|---|
| Antigenic Specificity | TM4SF20 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TM4SF20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TM4SF20. This antibody reacts with human. The TM4SF20 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to TM4SF20 (transmembrane 4 L six family member 20) The peptide sequence was selected from the middle region of TM4SF20)(50ug). Peptide sequence QALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTG. |
|---|
| Other Names | FLJ22800, PRO994, TCCE518, transmembrane 4 L six family member 20, transmembrane 4 L6 family member 20 |
|---|
| Gene, Accession # | TM4SF20, Gene ID: 79853, Accession: Q53R12, SwissProt: Q53R12 |
|---|
| Catalog # | NBP1-59848 |
|---|
| Price | |
|---|
| Order / More Info | TM4SF20 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|