| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TMPRSS2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TMPRSS2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TMPRSS2. This antibody reacts with human. The TMPRSS2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TMPRSS2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GSPPAIGPYYENHGYQPENPYPAQPTVVPTVYEVHPAQYYPSPVPQYAPRVLTQASNPVVCTQPKSPSGTVCTSKT |
|---|
| Other Names | EC 3.4.21, EC 3.4.21.109, FLJ41954, PP9284, PRSS10epitheliasin, Serine protease 10, transmembrane protease serine 2, transmembrane protease, serine 2, transmembrane protease, serine 2, EC 3.4.2110EC 3.4.21.- |
|---|
| Gene, Accession # | TMPRSS2, Gene ID: 7113, Accession: O15393, SwissProt: O15393 |
|---|
| Catalog # | NBP2-38263 |
|---|
| Price | |
|---|
| Order / More Info | TMPRSS2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|