| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OMA1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OMA1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to OMA1. This antibody reacts with human. The OMA1 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human OMA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YLDRLIPQALKIREMCNCPPLSNPDPRLLFKLSTKHFLEESEKEDLNITKKQKMDTLPIQKQEQIPLTYIVEKRTGS |
|---|
| Other Names | 2010001O09Rik, DAB1, EC 3.4.24.-, metalloprotease related protein 1, Metalloprotease-related protein 1, MPRP1, MPRP-1mitochondrial, OMA1 homolog, zinc metallopeptidase (S. cerevisiae), overlapping activity with M-AAA protease, YKR087C, ZMPOMA1 |
|---|
| Gene, Accession # | OMA1, Gene ID: 115209, Accession: Q96E52, SwissProt: Q96E52 |
|---|
| Catalog # | NBP2-30971 |
|---|
| Price | |
|---|
| Order / More Info | OMA1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|