| Edit |   |
| Antigenic Specificity | MDS028 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MDS028 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MDS028. This antibody reacts with human. The MDS028 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MDS028 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KVLDASGHHETLIGEEQRPVFKQHIPANTKVMLISDIDGDGCRELVVGYTDRVVRAFRWEELGEGPEHLTGQLVSLKKWMLEGQVDSLSVTLGPL |
| Other Names | integrin alpha FG-GAP repeat containing 2, integrin-alpha FG-GAP repeat-containing protein 2, MDS028 |
| Gene, Accession # | ITFG2, Gene ID: 55846, Accession: Q969R8, SwissProt: Q969R8 |
| Catalog # | NBP2-38424 |
| Price | |
| Order / More Info | MDS028 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |