| 产品详情 |
| Edit |   |
| Antigenic Specificity | MDR3/ABCB4 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MDR3/ABCB4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MDR3/ABCB4. This antibody reacts with human. The MDR3/ABCB4 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MDR3/ABCB4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKSRLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVS |
| Other Names | ABC21, ATP-binding cassette sub-family B member 4, ATP-binding cassette, sub-family B (MDR/TAP), member 4, EC 3.6.3, EC 3.6.3.44, MDR2, MDR3MDR2/3, multidrug resistance protein 3, multiple drug resistance 3, P glycoprotein 3/multiple drug resistance 3, PFIC-3, P-glycoprotein 3, P-glycoprotein-3/multiple drug resistance-3, PGY3GBD1 |
| Gene, Accession # | ABCB4, Gene ID: 5244, Accession: P21439, SwissProt: P21439 |
| Catalog # | NBP2-30887 |
| Price | |
| Order / More Info | MDR3/ABCB4 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|