| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MeCP2 |
|---|
| Clone | 4B6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human, mouse, rat |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MeCP2 Antibody (4B6) from Novus Biologicals is a mouse monoclonal antibody to MeCP2. This antibody reacts with human, mouse, rat. The MeCP2 Antibody (4B6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | MECP2 (AAH11612, 81 a.a. - 170 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PKQRRSIIRDRGPMYDDPTLPEGWTRKLKQRKSGRSAGKYDVYLINPQGKAFRSKVELIAYFEKVGDTSLDPNDFDFTVTGRGSPSRREQ |
|---|
| Other Names | AUTSX3, DKFZp686A24160, MeCp-2 protein, mental retardation, X-linked 79, methyl CpG binding protein 2 (Rett syndrome), X-linked 16 |
|---|
| Gene, Accession # | MECP2, Gene ID: 4204, Accession: AAH11612, SwissProt: AAH11612 |
|---|
| Catalog # | H00004204-M01 |
|---|
| Price | |
|---|
| Order / More Info | MeCP2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 26842955, 27064487 |
|---|
| 产品资料 |
|
|