| Edit |   |
|---|
| Antigenic Specificity | Glutamate Dehydrogenase 2/GLUD2 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Glutamate Dehydrogenase 2/GLUD2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Glutamate Dehydrogenase 2/GLUD2. This antibody reacts with human. The Glutamate Dehydrogenase 2/GLUD2 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to GLUD2 (glutamate dehydrogenase 2) The peptide sequence was selected from the N terminal of GLUD2)(50ug). Peptide sequence EGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF. |
|---|
| Other Names | EC 1.4.1, EC 1.4.1.3, GDH 2, GDH2, GLUDP1, glutamate dehydrogenase 2, glutamate dehydrogenase 2, mitochondrial, glutamate dehydrogenase pseudogene 1 |
|---|
| Gene, Accession # | GLUD2, Gene ID: 2747, Accession: P49448, SwissProt: P49448 |
|---|
| Catalog # | NBP1-57732 |
|---|
| Price | |
|---|
| Order / More Info | Glutamate Dehydrogenase 2/GLUD2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|