| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RNF34 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RNF34 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RNF34. This antibody reacts with human. The RNF34 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of human RNF34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NIVCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKVKDL |
|---|
| Other Names | CARP1, Caspase regulator CARP1, Caspases-8 and -10-associated RING finger protein 1, E3 ubiquitin-protein ligase RNF34, EC 6.3.2, EC 6.3.2.-, FLJ21786, FYVE-RING finger protein Momo, hRFI, Human RING finger homologous to inhibitor of apoptosis protein, RFI, RIF, RIFF, ring finger protein 34CARP-1, RING finger protein RIFF |
|---|
| Gene, Accession # | RNF34, Gene ID: 80196 |
|---|
| Catalog # | NBP2-56413 |
|---|
| Price | |
|---|
| Order / More Info | RNF34 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|