| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP-24/MT5-MMP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MMP-24/MT5-MMP Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMP-24/MT5-MMP. This antibody reacts with human. The MMP-24/MT5-MMP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MMP24(matrix metallopeptidase 24 (membrane-inserted)) The peptide sequence was selected from the middle region of MMP24 (NP_006681). Peptide sequence GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW. |
|---|
| Other Names | EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 24 (membrane-inserted), matrix metalloproteinase 24 (membrane-inserted), matrix metalloproteinase-24, membrane-type 5 matrix metalloproteinase, Membrane-type matrix metalloproteinase 5, Membrane-type-5 matrix metalloproteinase, MMP-24, MT5MMP, MT5-MMPMMP25, MT-MMP 5, MTMMP5, MT-MMP5 |
|---|
| Gene, Accession # | MMP24, Gene ID: 10893, Accession: Q9Y5R2, SwissProt: Q9Y5R2 |
|---|
| Catalog # | NBP1-59458 |
|---|
| Price | |
|---|
| Order / More Info | MMP-24/MT5-MMP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18062926 |
|---|
| 产品资料 |
|
|