| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP-16/MT3-MMP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MMP-16/MT3-MMP Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMP-16/MT3-MMP. This antibody reacts with human. The MMP-16/MT3-MMP Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to MMP16(matrix metallopeptidase 16 (membrane-inserted)) The peptide sequence was selected from the N terminal of MMP16 (NP_005932). Peptide sequence ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA. |
|---|
| Other Names | chromosome 8 open reading frame 57, DKFZp761D112, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 16 (membrane-inserted), matrix metalloproteinase 16 (membrane-inserted), matrix metalloproteinase-16, Membrane-type matrix metalloproteinase 3, Membrane-type-3 matrix metalloproteinase, MMP-16, MMPX2, MMP-X2, MT3MMP, MT3-MMPC8orf57, MT-MMP 3, MT-MMP2, MTMMP3, MT-MMP3, Putative transmembrane protein C8orf57 |
|---|
| Gene, Accession # | MMP16, Gene ID: 4325, Accession: P51512, SwissProt: P51512 |
|---|
| Catalog # | NBP1-69349 |
|---|
| Price | |
|---|
| Order / More Info | MMP-16/MT3-MMP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|