| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | MMP-15/MT2-MMP |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The MMP-15/MT2-MMP Antibody from Novus Biologicals is a rabbit polyclonal antibody to MMP-15/MT2-MMP. This antibody reacts with human. The MMP-15/MT2-MMP Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human MMP-15/MT2-MMP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RDFMGCQEHVEPGPRWPDVARPPFNPHGGAEPGADSAEGDVGDGDGDFGAGVNKDGGSRVVVQMEEVARTVNVVMV |
|---|
| Other Names | EC 3.4.24, EC 3.4.24.-, EC 3.4.24.80, matrix metallopeptidase 15 (membrane-inserted), matrix metalloproteinase 15 (membrane-inserted), Membrane-type matrix metalloproteinase 2, Membrane-type-2 matrix metalloproteinase, MMP-15, MT2-MMPMT2MMP, MTMMP2MT-MMP 2, SMCP-2matrix metalloproteinase-15 |
|---|
| Gene, Accession # | MMP15, Gene ID: 4324 |
|---|
| Catalog # | NBP2-32613 |
|---|
| Price | |
|---|
| Order / More Info | MMP-15/MT2-MMP Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|