| Edit |   |
|---|
| Antigenic Specificity | SEC63 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SEC63 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SEC63. This antibody reacts with human. The SEC63 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to SEC63(SEC63 homolog (S. cerevisiae)) The peptide sequence was selected from the N terminal of SEC63. Peptide sequence WPRDQNAEQIRLKNIRKVYGRCMWYRLRLLKPQPNIIPTVKKIVLLAGWA. |
|---|
| Other Names | PRO2507, SEC63 homolog (S. cerevisiae), SEC63LERdj2, SEC63-like (S. cerevisiae), translocation protein SEC63 homolog |
|---|
| Gene, Accession # | SEC63, Gene ID: 11231, Accession: Q9UGP8, SwissProt: Q9UGP8 |
|---|
| Catalog # | NBP1-59954 |
|---|
| Price | |
|---|
| Order / More Info | SEC63 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|