| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NFATC3/NFAT4 |
|---|
| Clone | 3A12 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2b kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Antibody reactivity against recombinant protein on ELISA. It has been used for IHC-P. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NFATC3/NFAT4 Antibody (3A12) from Novus Biologicals is a mouse monoclonal antibody to NFATC3/NFAT4. This antibody reacts with human. The NFATC3/NFAT4 Antibody (3A12) has been validated for the following applications: ELISA, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | NFATC3 (NP_775188, 70 a.a. - 149 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREFLERPSRDHL |
|---|
| Other Names | NF-AT4, NFAT4nuclear factor of activated T-cells, cytoplasmic 3, NFATc3, NF-ATc3, NFATx, nuclear factor of activated T-cells c3 isoform IE-Xa, nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3, T cell transcription factor NFAT4, T-cell transcription factor NFAT4 |
|---|
| Gene, Accession # | NFATC3, Gene ID: 4775, Accession: NP_775188, SwissProt: NP_775188 |
|---|
| Catalog # | H00004775-M02 |
|---|
| Price | |
|---|
| Order / More Info | NFATC3/NFAT4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|