| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | GAT-1/SLC6A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The GAT-1/SLC6A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to GAT-1/SLC6A1. This antibody reacts with human, mouse. The GAT-1/SLC6A1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC6A1(solute carrier family 6 (neurotransmitter transporter, GABA), member 1) The peptide sequence was selected from the middle region of SLC6A1. Peptide sequence CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPG |
|---|
| Other Names | GABA Transporter 1, GABATHG, GABATRGAT-1, GABT1, GAT1sodium- and chloride-dependent GABA transporter 1, solute carrier family 6 (neurotransmitter transporter, GABA), member 1, Solute carrier family 6 member 1 |
|---|
| Gene, Accession # | SLC6A1, Gene ID: 6529, Accession: P30531, SwissProt: P30531 |
|---|
| Catalog # | NBP1-59878 |
|---|
| Price | |
|---|
| Order / More Info | GAT-1/SLC6A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|