| Edit |   |
| Antigenic Specificity | Tankyrase binding protein 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The Tankyrase binding protein 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Tankyrase binding protein 1. This antibody reacts with human. The Tankyrase binding protein 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Tankyrase binding protein 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EVLASPDRLWGSRLTFNHDGSSRYGPRTYGTTTAPRDEDGSTLFRGWSQEGPVKSPAECREEHSKTPEERSLPSDLAFNGDLAKAASSELPAD |
| Other Names | KIAA1741TAB182FLJ45975,182 kDa tankyrase-1-binding protein, tankyrase 1 binding protein 1, 182kDa, tankyrase 1-binding protein of 182 kDa |
| Gene, Accession # | TNKS1BP1, Gene ID: 85456, Accession: Q9C0C2, SwissProt: Q9C0C2 |
| Catalog # | NBP2-34041 |
| Price | |
| Order / More Info | Tankyrase binding protein 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |