| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARMC9 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARMC9 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARMC9. This antibody reacts with human. The ARMC9 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ARMC9 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: HESELLGLVKEYLDFAEFEDTLKTFSKECKIKGKPLCKTVGGSFRDSKSLTIQKDLVAAFDNGDQKVFFDLWEEHISSSIRD |
|---|
| Other Names | ARM, armadillo repeat containing 9, armadillo/beta-catenin-like repeats, FLJ12584, KIAA1868, KU-MEL-1, lisH domain-containing protein ARMC9, melanoma/melanocyte specific protein KU-MEL-1, Melanoma/melanocyte-specific tumor antigen KU-MEL-1, NS21 |
|---|
| Gene, Accession # | ARMC9, Gene ID: 80210, Accession: Q7Z3E5, SwissProt: Q7Z3E5 |
|---|
| Catalog # | NBP1-88991 |
|---|
| Price | |
|---|
| Order / More Info | ARMC9 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|