| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARMC5 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. WB application of this antibody was reported in PMID 24601692. The predicted molecular weight of ARMC5 protein is 97.7 kDa, however, PMID 24601692 shows that in human samples, this protein runs at 75 kDa position. WB, IHC-P reported in the scientific literature (PMID: 25822102). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARMC5 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARMC5. This antibody reacts with human. The ARMC5 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARMC5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PSAVSSSSPTPPVRLRKTLDLALSILADCCTEGACRTEVRRLGGILPLVTILQCMKTDSIQN |
|---|
| Other Names | armadillo repeat containing 5, armadillo repeat-containing protein 5, FLJ00019, FLJ13063 |
|---|
| Gene, Accession # | ARMC5, Gene ID: 79798, Accession: Q96C12, SwissProt: Q96C12 |
|---|
| Catalog # | NBP1-94024 |
|---|
| Price | |
|---|
| Order / More Info | ARMC5 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 24601692, 25822102, 27568465 |
|---|
| 产品资料 |
|
|