| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | ARMC4 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 25192045). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARMC4 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARMC4. This antibody reacts with human, mouse. The ARMC4 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human ARMC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHG |
|---|
| Other Names | armadillo repeat containing 4, armadillo repeat-containing protein 4, DKFZP434P1735, FLJ10376, FLJ10817, FLJ32798 |
|---|
| Gene, Accession # | ARMC4, Gene ID: 55130, Accession: Q5T2S8, SwissProt: Q5T2S8 |
|---|
| Catalog # | NBP1-84175 |
|---|
| Price | |
|---|
| Order / More Info | ARMC4 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 23435261, 23849778, 24203976, 25192045 |
|---|
| 产品资料 |
|
|