| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Coatomer Subunit Delta |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Coatomer Subunit Delta Antibody from Novus Biologicals is a rabbit polyclonal antibody to Coatomer Subunit Delta. This antibody reacts with human. The Coatomer Subunit Delta Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human Coatomer Subunit Delta antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPN |
|---|
| Other Names | Archain, archain 1, archain vesicle transport protein 1, coatomer delta subunit, coatomer protein complex, subunit delta, coatomer protein delta-COP, coatomer subunit delta, COPD, Delta-coat protein, delta-COP |
|---|
| Gene, Accession # | ARCN1, Gene ID: 372 |
|---|
| Catalog # | NBP2-55235 |
|---|
| Price | |
|---|
| Order / More Info | Coatomer Subunit Delta Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|