| Edit |   |
|---|
| Antigenic Specificity | ARPC5L |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The ARPC5L Antibody from Novus Biologicals is a rabbit polyclonal antibody to ARPC5L. This antibody reacts with human. The ARPC5L Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human ARPC5L antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV |
|---|
| Other Names | actin related protein 2/3 complex, subunit 5-like, actin-related protein 2/3 complex subunit 5-like protein, ARC16-2MGC3038, Arp2/3 complex 16 kDa subunit 2 |
|---|
| Gene, Accession # | ARPC5L, Gene ID: 81873, Accession: Q9BPX5, SwissProt: Q9BPX5 |
|---|
| Catalog # | NBP1-89017 |
|---|
| Price | |
|---|
| Order / More Info | ARPC5L Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|