| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | CaMKK alpha |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The CaMKK alpha Antibody from Novus Biologicals is a rabbit polyclonal antibody to CaMKK alpha. This antibody reacts with human. The CaMKK alpha Antibody has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS |
|---|
| Other Names | calcium/calmodulin-dependent protein kinase kinase 1, calcium/calmodulin-dependent protein kinase kinase 1, alpha, Calcium/calmodulin-dependent protein kinase kinase alpha, CaM-kinase IV kinase, CaM-kinase kinase 1, CaM-kinase kinase alpha, CaM-KK 1, CaMKK alpha, CaM-KK alpha, CAMKK alpha protein, CAMKKACaMKK 1, DKFZp761M0423, EC 2.7.11, EC 2.7.11.17, MGC34095 |
|---|
| Gene, Accession # | CAMKK1, Gene ID: 84254 |
|---|
| Catalog # | NBP1-88208 |
|---|
| Price | |
|---|
| Order / More Info | CaMKK alpha Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|