| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | RBMY1A1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified, no preservative |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The RBMY1A1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to RBMY1A1. This antibody reacts with human. The RBMY1A1 Antibody has been validated for the following applications: Western Blot. |
|---|
| Immunogen | Synthetic peptides corresponding to RBMY1A1(RNA binding motif protein, Y-linked, family 1, member A1) The peptide sequence was selected from the N terminal of RBMY1A1. Peptide sequence MSYSRGLIPVKRGPSSRSGGPPPKKSAPSAVARSNSWMGSQGPMSQRREN. |
|---|
| Other Names | MGC181956, RBM, RBM1, RBM2, RBMY, RBMY1C, RNA binding motif protein, Y chromosome, family 1, member A1, RNA binding motif protein, Y-linked, family 1, member A1, RNA binding protein, RNA-binding motif protein 1, RNA-binding motif protein 2, RNA-binding motif protein, Y chromosome, family 1 member A1/C, y chromosome RNA recognition motif 1, YRRM1, YRRM2 |
|---|
| Gene, Accession # | RBMY1A1, Gene ID: 5940, Accession: Q15414, SwissProt: Q15414 |
|---|
| Catalog # | NBP1-57363-20ul |
|---|
| Price | |
|---|
| Order / More Info | RBMY1A1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|