| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | EGR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The EGR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to EGR1. This antibody reacts with human. The EGR1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human EGR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: FPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSND |
|---|
| Other Names | AT225Transcription factor ETR103, early growth response 1, early growth response protein 1, EGR-1, G0S30, KROX24, KROX-24, Nerve growth factor-induced protein A, NGFI-ATranscription factor Zif268, TIS8, ZIF-268, Zinc finger protein Krox-24, ZNF225Zinc finger protein 225 |
|---|
| Gene, Accession # | EGR1, Gene ID: 1958 |
|---|
| Catalog # | NBP2-56100 |
|---|
| Price | |
|---|
| Order / More Info | EGR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|