| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | OCRL |
|---|
| Clone | 4A6 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG2a kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA, Immunohistochemistry-Paraffin, RNA Inhibition. Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P, RNAi Validation and ELISA. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The OCRL Antibody (4A6) from Novus Biologicals is a mouse monoclonal antibody to OCRL. This antibody reacts with human. The OCRL Antibody (4A6) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry-Paraffin, RNA Inhibition. |
|---|
| Immunogen | OCRL (NP_000267 146 a.a. - 239 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SGLLGFEDNFSSMNLDKKINSQNQPTGIHREPPPPPFSVNKMLPREKEASNKEQPKVTNTMRKLFVPNTQSGQREGLIKHILAKREKEYVNIQT |
|---|
| Other Names | EC 3.1.3.36, INPP5F, LOCR, Lowe oculocerebrorenal syndrome protein, NPHL2, OCRL1inositol polyphosphate 5-phosphatase OCRL-1, oculocerebrorenal syndrome of Lowe, phosphatidylinositol polyphosphate 5-phosphatase |
|---|
| Gene, Accession # | OCRL, Gene ID: 4952, Accession: NP_000267, SwissProt: NP_000267 |
|---|
| Catalog # | H00004952-M02 |
|---|
| Price | |
|---|
| Order / More Info | OCRL Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|