| 产品详情 |
| Edit |   |
| Antigenic Specificity | nef-associated protein 1 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The nef-associated protein 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to nef-associated protein 1. This antibody reacts with human. The nef-associated protein 1 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human nef-associated protein 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STRSPHRPNAIGLTLAKLEKVEGGAIYLSGIDMIHGTPVLDIKPYIAEYDSPQNVMEPLADFNLQNNQHTPNTVSQSDSKTDSCDQRQLSGCDEPQPHHSTKRKPKCPED |
| Other Names | C9orf156, chromosome 9 open reading frame 156, EC 3.1.2.-, HSPC219, NAP1, NAP1Nef associated protein 1, Nef (lentivirus myristoylated factor) associated protein 1, nef-associated protein 1, RP11-23B15.3, Thioesterase NAP1 |
| Gene, Accession # | C9ORF156, Gene ID: 51531 |
| Catalog # | NBP2-56680 |
| Price | |
| Order / More Info | nef-associated protein 1 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|