| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SLC6A18 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 20ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SLC6A18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A18. This antibody reacts with human. The SLC6A18 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
|---|
| Immunogen | Synthetic peptides corresponding to SLC6A18(solute carrier family 6, member 18) The peptide sequence was selected from the middle region of SLC6A18. Peptide sequence MHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDLHMPGAP. |
|---|
| Other Names | FLJ31236, Sodium- and chloride-dependent transporter XTRP2, sodium channel-like protein, sodium-dependent neutral amino acid transporter B(0)AT3, solute carrier family 6 (neurotransmitter transporter), member 18, Solute carrier family 6 member 18, solute carrier family 6, member 18, System B(0) neutral amino acid transporter AT3, XTRP2 |
|---|
| Gene, Accession # | SLC6A18, Gene ID: 348932, Accession: Q96N87, SwissProt: Q96N87 |
|---|
| Catalog # | NBP1-59903-20ul |
|---|
| Price | |
|---|
| Order / More Info | SLC6A18 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|