| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC6A18 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC6A18 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A18. This antibody reacts with human. The SLC6A18 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human SLC6A18 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GFKATNDYEHCLDRNILSLINDFDFPEQSISRDDYPAVLMHLNATWPKRVAQLPLKACLLEDFLDKSASGPGLAFVVFTETDL |
| Other Names | FLJ31236, Sodium- and chloride-dependent transporter XTRP2, sodium channel-like protein, sodium-dependent neutral amino acid transporter B(0)AT3, solute carrier family 6 (neurotransmitter transporter), member 18, Solute carrier family 6 member 18, solute carrier family 6, member 18, System B(0) neutral amino acid transporter AT3, XTRP2 |
| Gene, Accession # | SLC6A18, Gene ID: 348932 |
| Catalog # | NBP1-82024 |
| Price | |
| Order / More Info | SLC6A18 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 23435261 |
| 产品资料 |
|
|