| Edit |   |
| Antigenic Specificity | SLC6A16 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC6A16 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A16. This antibody reacts with human. The SLC6A16 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SLC6A16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SQSFQFPVPWEKCPLTMNSSGFDPECERTTPSIYFWYQQALKASDRIEDGGSP |
| Other Names | NTT5solute carrier family 6 (neurotransmitter transporter), member 16, orphan sodium- and chloride-dependent neurotransmitter transporter NTT5, Solute carrier family 6 member 16, solute carrier family 6, member 16 |
| Gene, Accession # | SLC6A16, Gene ID: 28968 |
| Catalog # | NBP2-57364 |
| Price | |
| Order / More Info | SLC6A16 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |