| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC6A15 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 20ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC6A15 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A15. This antibody reacts with human. The SLC6A15 Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to SLC6A15 (solute carrier family 6 (neutral amino acid transporter), member 15) The peptide sequence was selected from the middle region of SLC6A15)(50ug). Peptide sequence YISPLMLLSLLIASVVNMGLSPPGYNAWIEDKA |
| Other Names | B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3 |
| Gene, Accession # | SLC6A15, Gene ID: 55117, Accession: Q9H2J7, SwissProt: Q9H2J7 |
| Catalog # | NBP1-59653-20ul |
| Price | |
| Order / More Info | SLC6A15 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|