| 产品详情 |
| Edit |   |
| Antigenic Specificity | SLC6A14 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SLC6A14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to SLC6A14. This antibody reacts with human. The SLC6A14 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human SLC6A14 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FQSELPWKNCSSWSDKNCSRSPIVTHCNVSTVNKGIQEIIQMNKSWVDINNFTCINGSEIYQPGQLPSEQYWNKVALQRSSGMNETG |
| Other Names | Amino acid transporter ATB0+, amino acid transporter B0+, BMIQ11, OBX, sodium- and chloride-dependent neutral and basic amino acid transporter B(0+), solute carrier family 6 (amino acid transporter), member 14, solute carrier family 6 (neurotransmitter transporter), member 14, Solute carrier family 6 member 14 |
| Gene, Accession # | SLC6A14, Gene ID: 11254, Accession: Q9UN76, SwissProt: Q9UN76 |
| Catalog # | NBP1-86521 |
| Price | |
| Order / More Info | SLC6A14 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | PubMed: 22236876, 26106611 |
| 产品资料 |
|
|