| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | FAT10 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunohistochemistry reported in scientific literature (PMID: 25647729). |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The FAT10 Antibody from Novus Biologicals is a rabbit polyclonal antibody to FAT10. This antibody reacts with human. The FAT10 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLG SKILKPRRSLSSYGIDKEKTIHLTLKVVKP |
|---|
| Other Names | Diubiquitin, FAT10diubiquitin, GABBR1, UBD-3, ubiquitin D, Ubiquitin-like protein FAT10 |
|---|
| Gene, Accession # | UBD, Gene ID: 10537 |
|---|
| Catalog # | NBP2-13498 |
|---|
| Price | |
|---|
| Order / More Info | FAT10 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 25647729 |
|---|
| 产品资料 |
|
|