| Edit |   |
| Antigenic Specificity | TIN-Ag |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Western Blot |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The TIN-Ag Antibody from Novus Biologicals is a rabbit polyclonal antibody to TIN-Ag. This antibody reacts with human. The TIN-Ag Antibody has been validated for the following applications: Western Blot. |
| Immunogen | Synthetic peptides corresponding to TINAG (tubulointerstitial nephritis antigen) The peptide sequence was selected from the middle region of TINAG. Peptide sequence VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG. |
| Other Names | TIN1, TIN2, TIN-AG, tubulointerstitial nephritis antigen |
| Gene, Accession # | TINAG, Gene ID: 27283, Accession: Q9UJW2, SwissProt: Q9UJW2 |
| Catalog # | NBP1-56968 |
| Price | |
| Order / More Info | TIN-Ag Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |