| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | TINAGL1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The TINAGL1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TINAGL1. This antibody reacts with human. The TINAGL1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human TINAGL1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSS SVMNMHEIYTVLNPGEVLPTAFEASEKWPNLI |
|---|
| Other Names | androgen-regulated gene 1, ARG1, GIS5, Glucocorticoid-inducible protein 5, LCN7, LIECG3, lipocalin 7, OLRG2, OLRG-2, Oxidized LDL-responsive gene 2 protein, oxidized-LDL responsive gene 2, P3ECSL, TIN Ag-related protein, TINAGL, TINAG-like 1, TIN-Ag-RP, TINAGRP, tubulointerstitial nephritis antigen-like, tubulointerstitial nephritis antigen-like 1, Tubulointerstitial nephritis antigen-related protein |
|---|
| Gene, Accession # | TINAGL1, Gene ID: 64129 |
|---|
| Catalog # | NBP2-13434 |
|---|
| Price | |
|---|
| Order / More Info | TINAGL1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|