| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NLRP1/NALP1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human, mouse |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NLRP1/NALP1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NLRP1/NALP1. This antibody reacts with human, mouse. The NLRP1/NALP1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Frozen. |
|---|
| Immunogen | Synthetic peptides corresponding to NLRP1(NLR family, pyrin domain containing 1) The peptide sequence was selected from the N terminal of NLRP1 (NP_001028225). DTQEPRIVILQGAAGIGKSTLARQVKEAWGRGQLYGDRFQHVFYFSCREL. |
|---|
| Other Names | CARD7SLEV1, Caspase recruitment domain-containing protein 7, CLR17.1, Death effector filament-forming ced-4-like apoptosis protein, DEFCAPVAMAS1, DKFZp586O1822, KIAA0926DEFCAP-L/S, NACHT, leucine rich repeat and PYD (pyrin domain) containing 1, NACHT, leucine rich repeat and PYD containing 1, NACHT, LRR and PYD containing protein 1, NACHT, LRR and PYD domains-containing protein 1, NACPP1044, NALP1caspase recruitment domain protein 7, NLR family, pyrin domain containing 1, Nucleotide-binding domain and caspase recruitment domain, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 1 |
|---|
| Gene, Accession # | NLRP1, Gene ID: 22861, Accession: Q9C000, SwissProt: Q9C000 |
|---|
| Catalog # | NBP1-54899 |
|---|
| Price | |
|---|
| Order / More Info | NLRP1/NALP1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 18263805, 24008734, 24805069, 25626361, 28164443 |
|---|
| 产品资料 |
|
|