| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NLRP7 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NLRP7 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NLRP7. This antibody reacts with human. The NLRP7 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human NLRP7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LNEDELKSFKSLLWAFPLEDVLQKTPWSEVEEADGKKLAEILVNTSSENW IRNATVNILEEMNLTELCKMAK |
|---|
| Other Names | CLR19.4, MGC126471, NACHT, leucine rich repeat and PYD containing 7, NACHT, LRR and PYD containing protein 7, NACHT, LRR and PYD domains-containing protein 7, NALP7MGC126470, NLR family, pyrin domain containing 7, NOD12HYDM, Nucleotide-binding oligomerization domain protein 12, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 7, PAN7, PYPAF3FLJ94610, PYRIN-containing APAF1-like protein 3 |
|---|
| Gene, Accession # | NLRP7, Gene ID: 199713 |
|---|
| Catalog # | NBP2-13661 |
|---|
| Price | |
|---|
| Order / More Info | NLRP7 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|