| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | NLRP11 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | Protein A purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100 |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The NLRP11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to NLRP11. This antibody reacts with human. The NLRP11 Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LRELHIFDNDLNGISERILSKALEHSSCKLRTLKLSYVSTASGFEDLLKALARNRSLTYLSINCTSISLNMFSLLHDILHEPTCQISHLSLMKCDLRASE |
|---|
| Other Names | CLR19.6, NACHT, leucine rich repeat and PYD containing 11, NALP11NACHT, LRR and PYD domains-containing protein 11, NLR family, pyrin domain containing 11, NOD17PYPAF7, Nucleotide-binding oligomerization domain protein 17, nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domaincontaining 11, PAAD- and NACHT-containing protein 10, PAAD- and NACHT-containing protein 10B, PAAD-and NACHT domain-containing protein 10, PAN10FLJ26273, PYPAF6NACHT, LRR and PYD containing protein 11, PYRIN-containing APAF1-like protein 6 |
|---|
| Gene, Accession # | NLRP11, Gene ID: 204801 |
|---|
| Catalog # | NBP2-69058 |
|---|
| Price | |
|---|
| Order / More Info | NLRP11 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|