| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SUR1/SUR2B |
|---|
| Clone | S323A-31 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | mouse, rat |
|---|
| Isotype | IgG1 |
|---|
| Format | Protein G purified |
|---|
| Size | 0.1 mg |
|---|
| Concentration | 1 mg/ml |
|---|
| Applications | Western Blot, Immunocytochemistry/Immunofluorescence. 1 ug/ml of SUR1 and SUR2B Antibody was sufficient for detection of SUR1 and SUR2B in 20 ug of mouse brain membrane lysate and assayed by colorimetric immunoblot analysis using goat anti-mouse IgG:HRP as the secondary Antibody. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SUR1/SUR2B Antibody (S323A-31) from Novus Biologicals is a mouse monoclonal antibody to SUR1/SUR2B. This antibody reacts with mouse, rat. The SUR1/SUR2B Antibody (S323A-31) has been validated for the following applications: Western Blot, Immunocytochemistry/Immunofluorescence. Detects approx 175kDa and smaller fragments likely due to proteolytic cleavage |
|---|
| Immunogen | Fusion protein amino acids 1503-1545 ([protein fragment, 43 aa], cytoplasmic C-terminus) of rat SUR2B |
|---|
| Other Names | ABC37, ATFB12, ATP Binding Cassette Subfamily C Member 9, ATP-Binding Cassette, Sub-Family C (CFTR/MRP), CANTU, CMD1O, EC 3.6.3.44, member 9, Sulfonylurea receptor 2 |
|---|
| Gene, Accession # | ABCC9, Gene ID: 25560, Accession: Q63563 |
|---|
| Catalog # | NBP2-22396 |
|---|
| Price | |
|---|
| Order / More Info | SUR1/SUR2B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|