| Edit |   |
|---|
| Antigenic Specificity | Centrin 2 |
|---|
| Clone | 3F8 |
|---|
| Host Species | Mouse |
|---|
| Reactive Species | human |
|---|
| Isotype | IgG1 kappa |
|---|
| Format | IgG purified, no preservative |
|---|
| Size | 0.1 mg |
|---|
| Concentration | n/a |
|---|
| Applications | Western Blot, ELISA. Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Centrin 2 Antibody (3F8) from Novus Biologicals is a mouse monoclonal antibody to Centrin 2. This antibody reacts with human. The Centrin 2 Antibody (3F8) has been validated for the following applications: Western Blot, ELISA. |
|---|
| Immunogen | CETN2 (NP_004335 85 a.a. - 172 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY |
|---|
| Other Names | Caltractin isoform 1, CEN2CALTcaltractin (20kD calcium-binding protein), centrin, EF-hand protein, 2, centrin-2 |
|---|
| Gene, Accession # | CETN2, Gene ID: 1069, Accession: NP_004335, SwissProt: NP_004335 |
|---|
| Catalog # | H00001069-M01 |
|---|
| Price | |
|---|
| Order / More Info | Centrin 2 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20368616 |
|---|