| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | SAMD4B |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | affinity purified |
|---|
| Size | 100 ul |
|---|
| Concentration | n/a |
|---|
| Applications | Immunocytochemistry/Immunofluorescence. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The SAMD4B Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAMD4B. This antibody reacts with human. The SAMD4B Antibody has been validated for the following applications: Immunocytochemistry/Immunofluorescence. Specificity of human SAMD4B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IIITPIKAYSVLQATVAAATTTPTAKDGAPGEPPLPGAEPPLAHPGTDKGTEAKDPPAVENYPPPP |
|---|
| Other Names | FLJ10211, hSmaug2, MGC99832, protein Smaug homolog 2, SAM domain-containing protein 4B, smaug 2, smaug homolog B, SMAUG2, SMGB, sterile alpha motif domain containing 4B, sterile alpha motif domain-containing protein 4B |
|---|
| Gene, Accession # | SAMD4B, Gene ID: 55095 |
|---|
| Catalog # | NBP2-55800 |
|---|
| Price | |
|---|
| Order / More Info | SAMD4B Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | n/a |
|---|
| 产品资料 |
|
|