| 产品详情 |
| Edit |   |
| Antigenic Specificity | SAMD4A |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human, mouse, rat |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The SAMD4A Antibody from Novus Biologicals is a rabbit polyclonal antibody to SAMD4A. This antibody reacts with human, mouse, rat. The SAMD4A Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human, mouse, rat SAMD4A antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MWLNHLEDRTSTSFGGQNRGRSDSVDYGQTHYYHQRQNSDDKLNGWQNSR DSGICINASNWQDKSMGCENGHVPLYSSSSVPTTINTIGTSTS |
| Other Names | DKFZp434H0350, DKFZp686A1532, hSmaug1DKFZP434H0350, KIAA1053SMAUG1, protein Smaug homolog 1, SAM domain-containing protein 4A, SAMD4, Smaug, Smaug 1, smaug homolog, Smaug1, SMG, SMGA, sterile alpha motif domain containing 4, sterile alpha motif domain containing 4A, Sterile alpha motif domain-containing protein 4A |
| Gene, Accession # | SAMD4A, Gene ID: 23034 |
| Catalog # | NBP2-13279 |
| Price | |
| Order / More Info | SAMD4A Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|