| 产品详情 |
| Edit |   |
| Antigenic Specificity | MYST3 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | affinity purified |
| Size | 100 ul |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The MYST3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to MYST3. This antibody reacts with human. The MYST3 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human MYST3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSAPQEQYGECGEKSEATQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKCRLTEGSE |
| Other Names | EC 2.3.1.48, EC 3.1.26.4, histone acetyltransferase MYST3, KAT6A, MGC167033, MOZMonocytic leukemia zinc finger protein, MYST histone acetyltransferase (monocytic leukemia) 3, MYST-3, runt-related transcription factor binding protein 2, Runt-related transcription factor-binding protein 2, RUNXBP2, Zinc finger protein 220, ZNF220MOZ, YBF2/SAS3, SAS2 and TIP60 protein 3 |
| Gene, Accession # | KAT6A, Gene ID: 7994 |
| Catalog # | NBP2-56972 |
| Price | |
| Order / More Info | MYST3 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|