| 产品详情 |
| Edit |   |
| Antigenic Specificity | CD20 |
| Clone | polyclonal |
| Host Species | Rabbit |
| Reactive Species | human |
| Isotype | n/a |
| Format | immunogen affinity purified |
| Size | 0.1 ml |
| Concentration | n/a |
| Applications | Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
| Description | The CD20 Antibody from Novus Biologicals is a rabbit polyclonal antibody to CD20. This antibody reacts with human. The CD20 Antibody has been validated for the following applications: Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin. Specificity of human CD20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MESLNFIRAHTPYINIYNCEPANPSEKNSPSTQYCY |
| Other Names | B1, B-lymphocyte antigen CD20, B-lymphocyte cell-surface antigen B1, B-lymphocyte surface antigen B1, Bp35MGC3969, CD20 antigen, CD20 receptor, CD20S7, CVID5, LEU-16, Leukocyte surface antigen Leu-16, Membrane-spanning 4-domains subfamily A member 1, membrane-spanning 4-domains, subfamily A, member 1, MS4A2 |
| Gene, Accession # | MS4A1, Gene ID: 931 |
| Catalog # | NBP1-90052 |
| Price | |
| Order / More Info | CD20 Antibody from NOVUS BIOLOGICALS, LLC |
| Product Specific References | n/a |
| 产品资料 |
|
|