| 产品详情 |
| Edit |   |
|---|
| Antigenic Specificity | Orexin R1/HCRTR1 |
|---|
| Clone | polyclonal |
|---|
| Host Species | Rabbit |
|---|
| Reactive Species | human |
|---|
| Isotype | n/a |
|---|
| Format | immunogen affinity purified |
|---|
| Size | 0.1 ml |
|---|
| Concentration | n/a |
|---|
| Applications | Immunohistochemistry, Immunohistochemistry-Paraffin. For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
|---|
| Reviews / Ratings | If you have used this antibody, please help fellow researchers by submitting reviews to pAbmAbs and antYbuddY. |
|---|
| Description | The Orexin R1/HCRTR1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Orexin R1/HCRTR1. This antibody reacts with human. The Orexin R1/HCRTR1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin. Specificity of human Orexin R1/HCRTR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins |
|---|
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV |
|---|
| Other Names | hypocretin (orexin) receptor 1, hypocretin receptor 1, Hypocretin receptor type 1, hypocretin receptor-1, orexin receptor 1, orexin receptor type 1, orexin receptor-1, ox-1-R, Ox1-R, OX1R |
|---|
| Gene, Accession # | HCRTR1, Gene ID: 3061 |
|---|
| Catalog # | NBP1-82463 |
|---|
| Price | |
|---|
| Order / More Info | Orexin R1/HCRTR1 Antibody from NOVUS BIOLOGICALS, LLC |
|---|
| Product Specific References | PubMed: 20682762 |
|---|
| 产品资料 |
|
|